PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG031061.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YA
Protein Properties Length: 348aa    MW: 38435.8 Da    PI: 6.8019
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG031061.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.11.7e-29168224158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  ++p++VNaKQy +I++RR++Rak+e +kkl +k rkpylheSRh+hA+rR+R+sgGrF
  CCG031061.1 168 QDPVFVNAKQYPGIIRRREQRAKAEVDKKL-IKDRKPYLHESRHRHAMRRERSSGGRF 224
                  58****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.8E-33166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115233.062167227IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.7E-21170192IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.2E-26170224IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860172192IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.7E-21201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MQSKPEKTIV PEPNQSGTQQ YTVHSEPWWR NIGYSSMPPA MTGGNISNSE GHNGSESNDD  60
QSLSSGRLNE EDADAIKDSQ ATASSQLGNH GHLQNLQGLV SSMTTMHNGL SQSPQFELVS  120
HSIACASNPY QDPYYSGMMA YGHHQPVGYP QFVGMPHARM LLPLEVAQDP VFVNAKQYPG  180
IIRRREQRAK AEVDKKLIKD RKPYLHESRH RHAMRRERSS GGRFAKKTGD DASKNTSEGK  240
LNGSGLVHAS QSRSSSGSEL LPSDSVETWN SSDGQKEARE SQVHDTFEAH DYVNRGCHYQ  300
KHSGLQSSAY GSYLGDNEDG DRSGENEDED RPGQQLGNQA KRRSFGPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-16168241275NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1208217RHRHAMRRER
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025538.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_011025539.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_011025541.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_011025542.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_011025543.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
SwissprotQ9LXV52e-73NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLB9HNX20.0B9HNX2_POPTR; CCAAT-binding transcription factor family protein
STRINGPOPTR_0009s05760.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40123461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.41e-65nuclear factor Y, subunit A1